Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

POU6F2 Peptide - C-terminal region

POU6F2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

RPF-1, WT5, WTSL

UniProt

P78424

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with POU6F2 Rabbit Polyclonal Antibody (orb330027) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_009183

Preservative

Lyophilized powder

AA Sequence

PSKKRKRRTSFTPQALEILNAHFEKNTHPSGQEMTEIAEKLNYDREVVRV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit ATP binding cassette sub family A member 8 (ABCA8) ELISA kit
GTR10436333 96 Well

Rabbit ATP binding cassette sub family A member 8 (ABCA8) ELISA kit

Sign In for Pricing
View Details
Anti-PROS1 Polyclonal Antibody
HY137014-01 50 µg

Anti-PROS1 Polyclonal Antibody

Sign In for Pricing
View Details
Anti-PROS1 Polyclonal Antibody
HY137014-02 100 µg

Anti-PROS1 Polyclonal Antibody

Sign In for Pricing
View Details
UBTF (Upstream Binding Transcription Factor, RNA Polymerase I, NOR-90, UBF) (FITC)
253240-FITC 100 µL

UBTF (Upstream Binding Transcription Factor, RNA Polymerase I, NOR-90, UBF) (FITC)

Sign In for Pricing
View Details
Human FER (NM_005246) AAV Particle
RC219948A1V 250 µL

Human FER (NM_005246) AAV Particle

Sign In for Pricing
View Details
IGHG1 Protein Vector (Human) (pPM-C-HA)
24380023 500 ng

IGHG1 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details