Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PPARGC1A Peptide - N-terminal region

PPARGC1A Peptide - N-terminal region

Product Specifications

Product Name Alternative

LEM6, PGC-1 (alpha), PGC-1v, PGC1, PGC1A, PPARGC1

UniProt

Q9UBK2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PPARGC1A Rabbit Polyclonal Antibody (orb330034) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_037393

Preservative

Lyophilized powder

AA Sequence

MAWDMCNQDSESVWSDIECAALVGEDQPLCPDLPELDLSELDVNDLDTDS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ACTA1 Monoclonal Antibody
E-AB-22135-01 20 µL

ACTA1 Monoclonal Antibody

Sign In for Pricing
View Details
ACTA1 Monoclonal Antibody
E-AB-22135-02 60 µL

ACTA1 Monoclonal Antibody

Sign In for Pricing
View Details
ACTA1 Monoclonal Antibody
E-AB-22135-03 120 µL

ACTA1 Monoclonal Antibody

Sign In for Pricing
View Details
ACTA1 Monoclonal Antibody
E-AB-22135-04 200 µL

ACTA1 Monoclonal Antibody

Sign In for Pricing
View Details
Rat sCD14 Antibody Pair Set
E-KAB-0678 50 µL & 100 µg

Rat sCD14 Antibody Pair Set

Sign In for Pricing
View Details
Frozen Tissue Sections, Prostate
CS631374 5x 5 µm

Frozen Tissue Sections, Prostate

Sign In for Pricing
View Details