PPARGC1A Peptide - N-terminal region
PPARGC1A Peptide - N-terminal region
Product Specifications
Product Name Alternative
LEM6, PGC-1 (alpha), PGC-1v, PGC1, PGC1A, PPARGC1
UniProt
Q9UBK2
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with PPARGC1A Rabbit Polyclonal Antibody (orb330034) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_037393
Preservative
Lyophilized powder
AA Sequence
MAWDMCNQDSESVWSDIECAALVGEDQPLCPDLPELDLSELDVNDLDTDS
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC743232-500 1x 500 µL
Cycloxygenase-2 (COX-2) (COX2/3232R), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details ![alpha Synuclein (SNCA) (also beta reactive) Mouse Monoclonal Antibody [Clone ID: 3B6]](https://cdn.genprice.uk/products/937/68dd189b061270361e8fc394/imageurl/am09033pu-n.webp)
AM09033PU-N 100 µL
alpha Synuclein (SNCA) (also beta reactive) Mouse Monoclonal Antibody [Clone ID: 3B6]
Sign In for Pricing
View Details 
TP760991 50 µg
C16orf65 (PDZD9) (NM_173806) Human Recombinant Protein
Sign In for Pricing
View Details 
BNC402051-100 1x 100 µL
TLE1 (Synovial Sarcoma Marker) (TLE1/2051), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details