PPHLN1 Peptide - N-terminal region
PPHLN1 Peptide - N-terminal region
Product Specifications
Product Name Alternative
HSPC206, HSPC232, MGC48786
UniProt
Q8NEY8
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with PPHLN1 Rabbit Polyclonal Antibody (orb583728) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_958923
Preservative
Lyophilized powder
AA Sequence
MAYRRDEMWSEGRYEYERIPRERAPPRSHPSDGYNRLVNIVPKKPPLLDR
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
ALX-805-709-C100 100 µg
HLA-E (human) monoclonal antibody (MEM-E/07)
Sign In for Pricing
View Details TL303912V 500 µL Each
PHF22 (INTS12) Human shRNA Lentiviral Particle (Locus ID 57117)
Sign In for Pricing
View Details OR1007741-01 250 mg
3-Chloro-N-methyl-5- (tetramethyl-1,3,2-dioxaborolan-2-yl) benzamide
Sign In for Pricing
View Details OR1007741-02 1 g
3-Chloro-N-methyl-5- (tetramethyl-1,3,2-dioxaborolan-2-yl) benzamide
Sign In for Pricing
View Details RC219614L4V 200 µL
SLC39A10 (NM_020342) Human Tagged ORF Clone Lentiviral Particle
Sign In for Pricing
View Details