Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PPIL3 Peptide - middle region

PPIL3 Peptide - middle region

Product Specifications

Product Name Alternative

CYPJ

UniProt

Q9H2H8

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PPIL3 Rabbit Polyclonal Antibody (orb581288) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_570981

Preservative

Lyophilized powder

AA Sequence

NYYNGCIFHRNIKGFMVQTGDPTGTGRGGNSIWGKKFEDEYSEYLKHNVR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hot Start Core Kit Ab+, S pack
JBS-PCR-216S 200 U

Hot Start Core Kit Ab+, S pack

Sign In for Pricing
View Details
Rat islet cell antibody, ICA ELISA Kit
CSB-E08811r-01 48 Tests

Rat islet cell antibody, ICA ELISA Kit

Sign In for Pricing
View Details
Rat islet cell antibody, ICA ELISA Kit
CSB-E08811r-02 96 Tests

Rat islet cell antibody, ICA ELISA Kit

Sign In for Pricing
View Details
Rat islet cell antibody, ICA ELISA Kit
CSB-E08811r-03 5x 96 Tests

Rat islet cell antibody, ICA ELISA Kit

Sign In for Pricing
View Details
Rat islet cell antibody, ICA ELISA Kit
CSB-E08811r-04 10x 96 Tests

Rat islet cell antibody, ICA ELISA Kit

Sign In for Pricing
View Details
Recombinant Clostridium botulinum Acetate kinase (ackA)
MBS1227739-01 0.02 mg (E-Coli)

Recombinant Clostridium botulinum Acetate kinase (ackA)

Sign In for Pricing
View Details