Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PPIL3 Peptide - middle region

PPIL3 Peptide - middle region

Product Specifications

Product Name Alternative

CYPJ

UniProt

Q9H2H8

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PPIL3 Rabbit Polyclonal Antibody (orb581288) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_570981

Preservative

Lyophilized powder

AA Sequence

NYYNGCIFHRNIKGFMVQTGDPTGTGRGGNSIWGKKFEDEYSEYLKHNVR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CRMP5 Rabbit Polyclonal Antibody (Cy5)
orb970828 100 µL

CRMP5 Rabbit Polyclonal Antibody (Cy5)

Sign In for Pricing
View Details
NCOR2 Knockout jurkat Polyclonal Cells
ARG12858 1 Million

NCOR2 Knockout jurkat Polyclonal Cells

Sign In for Pricing
View Details
Guinea pig Metabotropic glutamate receptor 7 (GRM7) ELISA Kit
MBS7232239-01 48 Well

Guinea pig Metabotropic glutamate receptor 7 (GRM7) ELISA Kit

Sign In for Pricing
View Details
Guinea pig Metabotropic glutamate receptor 7 (GRM7) ELISA Kit
MBS7232239-02 96 Well

Guinea pig Metabotropic glutamate receptor 7 (GRM7) ELISA Kit

Sign In for Pricing
View Details
Guinea pig Metabotropic glutamate receptor 7 (GRM7) ELISA Kit
MBS7232239-03 5x 96 Well

Guinea pig Metabotropic glutamate receptor 7 (GRM7) ELISA Kit

Sign In for Pricing
View Details
Guinea pig Metabotropic glutamate receptor 7 (GRM7) ELISA Kit
MBS7232239-04 10x 96 Well

Guinea pig Metabotropic glutamate receptor 7 (GRM7) ELISA Kit

Sign In for Pricing
View Details