Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ppip5k2 Peptide - C-terminal region

Ppip5k2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

AW555814, D330021B20, Hisppd1, Vip2, mKIAA0433

UniProt

E9PWR1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Ppip5k2 Rabbit Polyclonal Antibody (orb582667) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_776121

Preservative

Lyophilized powder

AA Sequence

SGYGYRPASRENEGRRSLKTDDDEPHTSKRDEVDRAVMLFKPLVSEPIHI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Integrin beta 1/CD29 MAb (Clone 419119)
MAB17784-SP 25 µg

Human Integrin beta 1/CD29 MAb (Clone 419119)

Sign In for Pricing
View Details
INHBB Antibody, HRP conjugated
A45489-100UG 100 µg

INHBB Antibody, HRP conjugated

Sign In for Pricing
View Details
Recombinant Human PDX1 Protein, His (Fc)-Avi-tagged
PDX1-1642H 50 µg

Recombinant Human PDX1 Protein, His (Fc)-Avi-tagged

Sign In for Pricing
View Details
Trypsin-1 CRISPR Activation Plasmid (h)
sc-401128-ACT 20 µg

Trypsin-1 CRISPR Activation Plasmid (h)

Sign In for Pricing
View Details
CTSZ protein (His tag)
80R-3034 100 ug

CTSZ protein (His tag)

Sign In for Pricing
View Details
Monkey Ischemia Modified Albumin ELISA kit
GTR10406839 96 Well

Monkey Ischemia Modified Albumin ELISA kit

Sign In for Pricing
View Details