Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ppip5k2 Peptide - C-terminal region

Ppip5k2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

AW555814, D330021B20, Hisppd1, Vip2, mKIAA0433

UniProt

E9PWR1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Ppip5k2 Rabbit Polyclonal Antibody (orb582667) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_776121

Preservative

Lyophilized powder

AA Sequence

SGYGYRPASRENEGRRSLKTDDDEPHTSKRDEVDRAVMLFKPLVSEPIHI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IRAK1 AAV Vector (Mouse) (CMV)
25071105 1 µg

IRAK1 AAV Vector (Mouse) (CMV)

Sign In for Pricing
View Details
Rabbit Monoclonal beta-Catenin Antibody (CTNNB1/2030R) [DyLight 755]
NBP2-79888IR 0.1 mL

Rabbit Monoclonal beta-Catenin Antibody (CTNNB1/2030R) [DyLight 755]

Sign In for Pricing
View Details
Glyatl3 (NM_001145060) Mouse Tagged ORF Clone Lentiviral Particle
MR215091L4V 200 µL

Glyatl3 (NM_001145060) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Haptoglobin (2I3) Rabbit Monoclonal Antibody
E28M2493 100 µL

Haptoglobin (2I3) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Mouse Monoclonal MIF Antibody (932606) [Alexa Fluor 488]
FAB2891G 0.1 mL

Mouse Monoclonal MIF Antibody (932606) [Alexa Fluor 488]

Sign In for Pricing
View Details
Recombinant Nuclear RNA Export Factor 3 (NXF3)
TRV-0046661-01 10 µg

Recombinant Nuclear RNA Export Factor 3 (NXF3)

Sign In for Pricing
View Details