Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ppip5k2 Peptide - C-terminal region

Ppip5k2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

AW555814, D330021B20, Hisppd1, Vip2, mKIAA0433

UniProt

E9PWR1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Ppip5k2 Rabbit Polyclonal Antibody (orb582667) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_776121

Preservative

Lyophilized powder

AA Sequence

SGYGYRPASRENEGRRSLKTDDDEPHTSKRDEVDRAVMLFKPLVSEPIHI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EED sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
K3005005 3x 1.0 µg

EED sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
Recombinant Mouse IL-4 Protein
PM0014E2 20 µg

Recombinant Mouse IL-4 Protein

Sign In for Pricing
View Details
Rhenium (VII) Oxide
30106-71 1 g

Rhenium (VII) Oxide

Sign In for Pricing
View Details
Anti-Phospho-GRK2 (Ser685) antibody
STJ99602 200 µl

Anti-Phospho-GRK2 (Ser685) antibody

Sign In for Pricing
View Details
GAD1 (Glutamate Decarboxylase 1 (Brain, 67kD), FLJ45882, GAD, SCP) (FITC)
246440-FITC 100 µL

GAD1 (Glutamate Decarboxylase 1 (Brain, 67kD), FLJ45882, GAD, SCP) (FITC)

Sign In for Pricing
View Details
GYG2 Rabbit Polyclonal Antibody
orb556948 100 µL

GYG2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details