Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PPP1R15B Peptide - C-terminal region

PPP1R15B Peptide - C-terminal region

Product Specifications

Product Name Alternative

CREP, FLJ14744

UniProt

Q5SWA1

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PPP1R15B Rabbit Polyclonal Antibody (orb584757) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_116222

Preservative

Lyophilized powder

AA Sequence

SFCSVDPYNPQNFTATIQTAARIVPEEPSDSEKDLSGKSDLENSSQSGSL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

JunD Recombinant Rabbit Monoclonal Antibody [SD0830]
ET1612-92 100 µL

JunD Recombinant Rabbit Monoclonal Antibody [SD0830]

Sign In for Pricing
View Details
Melanoma Marker (PNL2), CF647 conjugate, 0.1mg/mL
BNC470894-500 1x 500 µL

Melanoma Marker (PNL2), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Peruvoside (90%)
TRC-P227570-1MG 1 mg

Peruvoside (90%)

Sign In for Pricing
View Details
Digitoxigenin Mono-Beta-D-digitoxoside
TRC-D450835-1MG 1 mg

Digitoxigenin Mono-Beta-D-digitoxoside

Sign In for Pricing
View Details
CD56 / NCAM1 / NKH1 (Neuronal Cell Marker) (NCAM1/2217R), CF405S conjugate, 0.1mg/mL
BNC042217-500 1x 500 µL

CD56 / NCAM1 / NKH1 (Neuronal Cell Marker) (NCAM1/2217R), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ICOS Mouse Monoclonal Antibody [Clone ID: OTI6F5]
CF813218 100 µg

ICOS Mouse Monoclonal Antibody [Clone ID: OTI6F5]

Sign In for Pricing
View Details