Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PPP1R15B Peptide - C-terminal region

PPP1R15B Peptide - C-terminal region

Product Specifications

Product Name Alternative

CREP, FLJ14744

UniProt

Q5SWA1

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PPP1R15B Rabbit Polyclonal Antibody (orb584757) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_116222

Preservative

Lyophilized powder

AA Sequence

SFCSVDPYNPQNFTATIQTAARIVPEEPSDSEKDLSGKSDLENSSQSGSL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Iso Loratadine
TRC-I821050-5MG 5 mg

Iso Loratadine

Sign In for Pricing
View Details
Mouse 4930555G21Rik activation kit by CRISPRa
GA210141 1 Kit

Mouse 4930555G21Rik activation kit by CRISPRa

Sign In for Pricing
View Details
Double Stranded DNA (dsDNA) (DSD/958), CF568 conjugate, 0.1mg/mL
BNC680958-100 1x 100 µL

Double Stranded DNA (dsDNA) (DSD/958), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mouse Dst activation kit by CRISPRa
GA201141 1 Kit

Mouse Dst activation kit by CRISPRa

Sign In for Pricing
View Details
MTRES1 (NM_001142468) Human Over-expression Lysate
LY428114 100 µg

MTRES1 (NM_001142468) Human Over-expression Lysate

Sign In for Pricing
View Details
OAS3 Human Gene Knockout Kit (CRISPR)
KN422722 1 Kit

OAS3 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details