PPP1R2 Peptide - N-terminal region
PPP1R2 Peptide - N-terminal region
Product Specifications
Product Name Alternative
IPP2, MGC87148, IPP-2
UniProt
P41236
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with PPP1R2 Rabbit Polyclonal Antibody (orb585006) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_006232
Preservative
Lyophilized powder
AA Sequence
ASAEQPRGNVDEELSKKSQKWDEMNILATYHPADKDYGLMKIDEPSTPYH
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![Human IL-21 Recombinant Mouse Monoclonal Antibody [PSH02-48] - BSA and Azide free (Capture)](https://cdn.genprice.uk/products/992/68dd1c90061270361ea82b09/imageurl/ha601195.webp)
HA601195 100 µg
Human IL-21 Recombinant Mouse Monoclonal Antibody [PSH02-48] - BSA and Azide free (Capture)
Sign In for Pricing
View Details 
![AFAP (AFAP1) Mouse Monoclonal Antibody [Clone ID: OTI3G4]](https://cdn.genprice.uk/products/937/68dd18ba061270361e908858/imageurl/cf810440.webp)
CF810440 100 µg
AFAP (AFAP1) Mouse Monoclonal Antibody [Clone ID: OTI3G4]
Sign In for Pricing
View Details 
BNC743276-500 1x 500 µL
Cathepsin D (Tumor Marker) (CTSD/3276), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 