Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PPP1R2 Peptide - N-terminal region

PPP1R2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

IPP2, MGC87148, IPP-2

UniProt

P41236

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PPP1R2 Rabbit Polyclonal Antibody (orb585006) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_006232

Preservative

Lyophilized powder

AA Sequence

ASAEQPRGNVDEELSKKSQKWDEMNILATYHPADKDYGLMKIDEPSTPYH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FH Polyclonal Antibody
E-AB-11249-01 20 µL

FH Polyclonal Antibody

Sign In for Pricing
View Details
FH Polyclonal Antibody
E-AB-11249-02 60 µL

FH Polyclonal Antibody

Sign In for Pricing
View Details
FH Polyclonal Antibody
E-AB-11249-03 120 µL

FH Polyclonal Antibody

Sign In for Pricing
View Details
FH Polyclonal Antibody
E-AB-11249-04 200 µL

FH Polyclonal Antibody

Sign In for Pricing
View Details
Transport Vials
C1813-NS 1000 Units/Case

Transport Vials

Sign In for Pricing
View Details
Replacement generator pack, 7mm x 50mm saw tooth for microtubes, pack of 5
D1000-M7 1 Each

Replacement generator pack, 7mm x 50mm saw tooth for microtubes, pack of 5

Sign In for Pricing
View Details