Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PPP1R3B Peptide - N-terminal region

PPP1R3B Peptide - N-terminal region

Product Specifications

Product Name Alternative

FLJ14005, FLJ34675, GL, PPP1R4, PTG

UniProt

Q86XI6

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PPP1R3B Rabbit Polyclonal Antibody (orb585176) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_078883

Preservative

Lyophilized powder

AA Sequence

LSSKNEASGMVAPAVQEKKVKKRVSFADNQGLALTMVKVFSEFDDPLDMP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lce3f (BC060281) Mouse Tagged ORF Clone
MG200290 10 µg

Lce3f (BC060281) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
PI 3 Kinase p85 alpha (PIK3R1) Rabbit Polyclonal Antibody
TA366735 100 µL

PI 3 Kinase p85 alpha (PIK3R1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Desmoglein-1 (DSG1) (32-2B), CF594 conjugate, 0.1mg/mL
BNC943068-500 1x 500 µL

Desmoglein-1 (DSG1) (32-2B), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
BTNL8 Rabbit Polyclonal Antibody
HA500240 100 µL

BTNL8 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
PAR4 (PAWR) Rabbit Polyclonal Antibody
AP06292PU-N 100 µg

PAR4 (PAWR) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
6-Azidohexanoic Acid
TRC-A850030-5G 5 g

6-Azidohexanoic Acid

Sign In for Pricing
View Details