Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PPP1R3B Peptide - N-terminal region

PPP1R3B Peptide - N-terminal region

Product Specifications

Product Name Alternative

FLJ14005, FLJ34675, GL, PPP1R4, PTG

UniProt

Q86XI6

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PPP1R3B Rabbit Polyclonal Antibody (orb585176) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_078883

Preservative

Lyophilized powder

AA Sequence

LSSKNEASGMVAPAVQEKKVKKRVSFADNQGLALTMVKVFSEFDDPLDMP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue Total RNA, Skin
CR559161 5 µg

Tissue Total RNA, Skin

Sign In for Pricing
View Details
TOR3A antibody
FNab08874 100 µg

TOR3A antibody

Sign In for Pricing
View Details
5-Diazoimidazole-4-carboxamide
TRC-D416883-25MG 25 mg

5-Diazoimidazole-4-carboxamide

Sign In for Pricing
View Details
GP2 (Glycoprotein 2) / ZAP75 (GP2/1803), CF405S conjugate, 0.1mg/mL
BNC041803-500 1x 500 µL

GP2 (Glycoprotein 2) / ZAP75 (GP2/1803), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
beta-Ketoglutaric Acid
TRC-K191205-10G 10 g

beta-Ketoglutaric Acid

Sign In for Pricing
View Details
Purified Anti-Human CD38 Antibody[HB-7]
AN003490P-01 25 µg

Purified Anti-Human CD38 Antibody[HB-7]

Sign In for Pricing
View Details