Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ppp1r7 Peptide - C-terminal region

Ppp1r7 Peptide - C-terminal region

Product Specifications

Product Name Alternative

MGC105784, Sds22

UniProt

Q5HZV9

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Ppp1r7 Rabbit Polyclonal Antibody (orb583147) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001009825

Preservative

Lyophilized powder

AA Sequence

SHLTELQEFWMNDNLLESWSDLDELKGARSLETVYLERNPLQKDPQYRRK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pigeon NAD Kinase ELISA Kit
MBS063140 Inquire

Pigeon NAD Kinase ELISA Kit

Sign In for Pricing
View Details
Histone H4R3me1
319194 100 µL

Histone H4R3me1

Sign In for Pricing
View Details
RPL7P44-set siRNA/shRNA/RNAi Lentivector (Human)
41905091 4x 500 ng

RPL7P44-set siRNA/shRNA/RNAi Lentivector (Human)

Sign In for Pricing
View Details
Neuropeptide Y (NPY)
N2176-60N 100 µg

Neuropeptide Y (NPY)

Sign In for Pricing
View Details
Mouse Monoclonal HLCS Antibody (OTI1E4) [FITC]
NBP2-70893F 0.1 mL

Mouse Monoclonal HLCS Antibody (OTI1E4) [FITC]

Sign In for Pricing
View Details
mouse Monoclonal PGAM2 Antibody (5A7)
NBP2-59410-50ul 50 µL

mouse Monoclonal PGAM2 Antibody (5A7)

Sign In for Pricing
View Details