Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ppp1r7 Peptide - C-terminal region

Ppp1r7 Peptide - C-terminal region

Product Specifications

Product Name Alternative

MGC105784, Sds22

UniProt

Q5HZV9

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Ppp1r7 Rabbit Polyclonal Antibody (orb583147) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001009825

Preservative

Lyophilized powder

AA Sequence

SHLTELQEFWMNDNLLESWSDLDELKGARSLETVYLERNPLQKDPQYRRK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EXD1 AAV Vector (Rat) (CMV)
19553106 1 µg

EXD1 AAV Vector (Rat) (CMV)

Sign In for Pricing
View Details
Cntn2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)
K6770508 1.0 µg DNA

Cntn2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details
Phospho-p95 (Ser343) Rabbit mAb, 1 pack = 100 µL
BAL2402 1 Each

Phospho-p95 (Ser343) Rabbit mAb, 1 pack = 100 µL

Sign In for Pricing
View Details
AKAP4 Antibody
orb2680965-01 50 µL

AKAP4 Antibody

Sign In for Pricing
View Details
AKAP4 Antibody
orb2680965-02 100 µL

AKAP4 Antibody

Sign In for Pricing
View Details
AKAP4 Antibody
orb2680965-03 200 µL

AKAP4 Antibody

Sign In for Pricing
View Details