PPP1R8 Peptide - N-terminal region
PPP1R8 Peptide - N-terminal region
Product Specifications
Product Name Alternative
ARD-1, ARD1, NIPP-1, NIPP1, PRO2047
UniProt
Q12972
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with PPP1R8 Rabbit Polyclonal Antibody (orb577761) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_054829
Preservative
Lyophilized powder
AA Sequence
DKLIEKLIIDEKKYYLFGRNPDLCDFTIDHQSCSRVHAALVYHKHLKRVF
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC040008-100 1x 100 µL
MAGE A1 (MA454), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC041081-100 1x 100 µL
CD45RO (190-2F2.5), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC941429-500 1x 500 µL
E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC740018-100 1x 100 µL
Human Kappa Light Chain (L1C1), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details