PPP2R5D Peptide - middle region
PPP2R5D Peptide - middle region
Product Specifications
Product Name Alternative
B56D, MGC2134, MGC8949
UniProt
Q14738
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with PPP2R5D Rabbit Polyclonal Antibody (orb330943) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_006236
Preservative
Lyophilized powder
AA Sequence
ETEAVQMLKDIKKEKVLLRRKSELPQDVYTIKALEAHKRAEEFLTASQEA
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
GTC45823-01 50 mg
3-Chloro-5-fluoro-4-methoxybenzene-1-sulfonyl chloride
Sign In for Pricing
View Details GTC45823-02 0.5 g
3-Chloro-5-fluoro-4-methoxybenzene-1-sulfonyl chloride
Sign In for Pricing
View Details 
GTR15378807 1 Vial
Lentiviral human SPIRE1 sgRNA gene knockout kit - Lentiviral human SPIRE1 sgRNA gene knockout kit (25)
Sign In for Pricing
View Details 38484111 3x 1.0 µg
RANGRF sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
Sign In for Pricing
View Details A02387-2-Fluoro594 100 µg/Vial
Anti-FANCC Antibody Picoband® Fluoro594 Conjugated
Sign In for Pricing
View Details