Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PPP2R5D Peptide - middle region

PPP2R5D Peptide - middle region

Product Specifications

Product Name Alternative

B56D, MGC2134, MGC8949

UniProt

Q14738

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PPP2R5D Rabbit Polyclonal Antibody (orb330943) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_006236

Preservative

Lyophilized powder

AA Sequence

ETEAVQMLKDIKKEKVLLRRKSELPQDVYTIKALEAHKRAEEFLTASQEA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

UBTD1 CRISPRa sgRNA lentivector (set of three targets)(Human)
49052121 3x 1.0µg DNA

UBTD1 CRISPRa sgRNA lentivector (set of three targets)(Human)

Sign In for Pricing
View Details
Tert-Butyl N- (2-formyl-1-benzofuran-5-yl) carbamate
KVB28350-01 50 mg

Tert-Butyl N- (2-formyl-1-benzofuran-5-yl) carbamate

Sign In for Pricing
View Details
Tert-Butyl N- (2-formyl-1-benzofuran-5-yl) carbamate
KVB28350-02 0.5 g

Tert-Butyl N- (2-formyl-1-benzofuran-5-yl) carbamate

Sign In for Pricing
View Details
Mouse Gm4951 qPCR Primer Pair
QM62474S 200 Tests

Mouse Gm4951 qPCR Primer Pair

Sign In for Pricing
View Details
Rabbit Polyclonal Kinesin 5C Antibody
NB120-5630-0.025mg 0.025 mg

Rabbit Polyclonal Kinesin 5C Antibody

Sign In for Pricing
View Details
Quick Step Rat adrenergic alpha-1A receptor, ADRA1A ELISA Kit
QS0034Ra-01 48 Tests

Quick Step Rat adrenergic alpha-1A receptor, ADRA1A ELISA Kit

Sign In for Pricing
View Details