Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ppp2r5e Peptide - N-terminal region

Ppp2r5e Peptide - N-terminal region

Product Specifications

Product Name Alternative

4633401M22Rik, AI449017, B56beta

UniProt

Q61151

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Ppp2r5e Rabbit Polyclonal Antibody (orb330883) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_036154

Preservative

Lyophilized powder

AA Sequence

SCNIFRTLPPSDSNEFDPEEDEPTLEASWPHLQLVYEFFIRFLESQEFQP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NQO2 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3C11]
TA504744BM 100 µL

NQO2 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3C11]

Sign In for Pricing
View Details
Fructose 6 Phosphate Kinase Antibody
KC-1965-01 50 μL

Fructose 6 Phosphate Kinase Antibody

Sign In for Pricing
View Details
Fructose 6 Phosphate Kinase Antibody
KC-1965-02 100 µL

Fructose 6 Phosphate Kinase Antibody

Sign In for Pricing
View Details
Fructose 6 Phosphate Kinase Antibody
KC-1965-03 1 mL

Fructose 6 Phosphate Kinase Antibody

Sign In for Pricing
View Details
OAZ2 (C-term) Rabbit Polyclonal Antibody
AP52982PU-N 400 µL

OAZ2 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
2-Nitrobenzotrifluoride
TRC-N495018-50MG 50 mg

2-Nitrobenzotrifluoride

Sign In for Pricing
View Details