Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ppp2r5e Peptide - N-terminal region

Ppp2r5e Peptide - N-terminal region

Product Specifications

Product Name Alternative

4633401M22Rik, AI449017, B56beta

UniProt

Q61151

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Ppp2r5e Rabbit Polyclonal Antibody (orb330883) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_036154

Preservative

Lyophilized powder

AA Sequence

SCNIFRTLPPSDSNEFDPEEDEPTLEASWPHLQLVYEFFIRFLESQEFQP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

1-Vinylnaphthalene [Stabilized with 4000ppm tert-Butylcatechol]
TRC-V425000-25G 25 g

1-Vinylnaphthalene [Stabilized with 4000ppm tert-Butylcatechol]

Sign In for Pricing
View Details
Ulex europaeus Gel -UEA-I- Immobilized Lectin
AK-2201-2 2 mL

Ulex europaeus Gel -UEA-I- Immobilized Lectin

Sign In for Pricing
View Details
Lipoamide Dehydrogenase Antibody
KC-32161-01 50 μL

Lipoamide Dehydrogenase Antibody

Sign In for Pricing
View Details
Lipoamide Dehydrogenase Antibody
KC-32161-02 100 µL

Lipoamide Dehydrogenase Antibody

Sign In for Pricing
View Details
Lipoamide Dehydrogenase Antibody
KC-32161-03 1 mL

Lipoamide Dehydrogenase Antibody

Sign In for Pricing
View Details
Lymphocyte Activation Gene 3 (LAG3) Mouse Monoclonal Antibody [Clone ID: OTI9F10]
CF813027 100 µg

Lymphocyte Activation Gene 3 (LAG3) Mouse Monoclonal Antibody [Clone ID: OTI9F10]

Sign In for Pricing
View Details