Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PPP2R5E Peptide - N-terminal region

PPP2R5E Peptide - N-terminal region

Product Specifications

UniProt

Q16537

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PPP2R5E Rabbit Polyclonal Antibody (orb330882) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_006237

Preservative

Lyophilized powder

AA Sequence

QFRSQGKPIELTPLPLLKDVPSSEQPELFLKKLQQCCVIFDFMDTLSDLK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Meclizine N’-Oxide
TRC-M202710-5MG 5 mg

Meclizine N’-Oxide

Sign In for Pricing
View Details
HBE1 Polyclonal Antibody
E-AB-67593-01 60 µL

HBE1 Polyclonal Antibody

Sign In for Pricing
View Details
HBE1 Polyclonal Antibody
E-AB-67593-02 120 µL

HBE1 Polyclonal Antibody

Sign In for Pricing
View Details
HBE1 Polyclonal Antibody
E-AB-67593-03 200 µL

HBE1 Polyclonal Antibody

Sign In for Pricing
View Details
Grp75 Mouse Monoclonal Antibody [6-A9]
EM1701-23 100 µL

Grp75 Mouse Monoclonal Antibody [6-A9]

Sign In for Pricing
View Details
Human Neuropeptide Y Receptor Y1 (NPY1R) ELISA Kit
RD-NPY1R-Hu-01 96 Tests

Human Neuropeptide Y Receptor Y1 (NPY1R) ELISA Kit

Sign In for Pricing
View Details