Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PPP2R5E Peptide - N-terminal region

PPP2R5E Peptide - N-terminal region

Product Specifications

UniProt

Q16537

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PPP2R5E Rabbit Polyclonal Antibody (orb330882) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_006237

Preservative

Lyophilized powder

AA Sequence

QFRSQGKPIELTPLPLLKDVPSSEQPELFLKKLQQCCVIFDFMDTLSDLK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hydroxylamine-O-sulfonic Acid
TRC-H943765-50G 50 g

Hydroxylamine-O-sulfonic Acid

Sign In for Pricing
View Details
CBX4 Human Gene Knockout Kit (CRISPR)
KN416414 1 Kit

CBX4 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Vcl Mouse Gene Knockout Kit (CRISPR)
KN518869 1 Kit

Vcl Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CEP89 Polyclonal Antibody
E-AB-53169-01 20 µL

CEP89 Polyclonal Antibody

Sign In for Pricing
View Details
CEP89 Polyclonal Antibody
E-AB-53169-02 60 µL

CEP89 Polyclonal Antibody

Sign In for Pricing
View Details
CEP89 Polyclonal Antibody
E-AB-53169-03 120 µL

CEP89 Polyclonal Antibody

Sign In for Pricing
View Details