Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ppp3cb Peptide - C-terminal region

Ppp3cb Peptide - C-terminal region

Product Specifications

Product Name Alternative

1110063J16Rik, Calnb, CnAbeta, Cnab

UniProt

P48453

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Ppp3cb Rabbit Polyclonal Antibody (orb583596) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_032940

Preservative

Lyophilized powder

AA Sequence

ESVLTLKGLTPTGMLPSGVLAGGRQTLQSATVEAIEAEKAIRGFSPPHRI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tmprss11c (NM_001003979) Rat Untagged Clone
RN212526 10 µg

Tmprss11c (NM_001003979) Rat Untagged Clone

Sign In for Pricing
View Details
FAM158A Protein Vector (Human) (pPM-C-HA)
19806021 500 ng

FAM158A Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
FUBP1 Polyclonal Antibody, AbBy Fluor™ 647 Conjugated
bs-13224R-BF647 100 µL

FUBP1 Polyclonal Antibody, AbBy Fluor™ 647 Conjugated

Sign In for Pricing
View Details
MYBBP1A (Myb-binding protein 1A, P160, PAP2) (HRP)
MBS6427776-01 0.1 mL

MYBBP1A (Myb-binding protein 1A, P160, PAP2) (HRP)

Sign In for Pricing
View Details
MYBBP1A (Myb-binding protein 1A, P160, PAP2) (HRP)
MBS6427776-02 5x 0.1 mL

MYBBP1A (Myb-binding protein 1A, P160, PAP2) (HRP)

Sign In for Pricing
View Details
IL6 goat polyclonal antibody, Biotin
PP1028B1 25 µg

IL6 goat polyclonal antibody, Biotin

Sign In for Pricing
View Details