Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ppp3cb Peptide - C-terminal region

Ppp3cb Peptide - C-terminal region

Product Specifications

Product Name Alternative

1110063J16Rik, Calnb, CnAbeta, Cnab

UniProt

P48453

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Ppp3cb Rabbit Polyclonal Antibody (orb583596) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_032940

Preservative

Lyophilized powder

AA Sequence

ESVLTLKGLTPTGMLPSGVLAGGRQTLQSATVEAIEAEKAIRGFSPPHRI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CSB Double Nickase Plasmid (h)
sc-401287-NIC 20 µg

CSB Double Nickase Plasmid (h)

Sign In for Pricing
View Details
Human HTN1 ELISA Kit
E018694-01 1 Each

Human HTN1 ELISA Kit

Sign In for Pricing
View Details
Human HTN1 ELISA Kit
E018694-02 1 Each

Human HTN1 ELISA Kit

Sign In for Pricing
View Details
Apolipoprotein A-I (APOA1) (185-195) Heavy
CRB1300744 25 nmoL

Apolipoprotein A-I (APOA1) (185-195) Heavy

Sign In for Pricing
View Details
Mouse Sphingosine 1 Phosphate Receptor 3 (S1PR3) ELISA Kit
orb1947055-01 48 Tests

Mouse Sphingosine 1 Phosphate Receptor 3 (S1PR3) ELISA Kit

Sign In for Pricing
View Details
Mouse Sphingosine 1 Phosphate Receptor 3 (S1PR3) ELISA Kit
orb1947055-02 96 Tests

Mouse Sphingosine 1 Phosphate Receptor 3 (S1PR3) ELISA Kit

Sign In for Pricing
View Details