Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PPP6C Peptide - N-terminal region

PPP6C Peptide - N-terminal region

Product Specifications

Product Name Alternative

FLJ92648, MGC12249, PP6, PP6C

UniProt

O00743

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PPP6C Rabbit Polyclonal Antibody (orb585333) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001116841

Preservative

Lyophilized powder

AA Sequence

GNHESRQITQVYGFYDECQTKYGNANAWRYCTKVFDMLTVAALIDEQILC

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HLA-A Antibody
F40223-0.08ML 0.08 mL

HLA-A Antibody

Sign In for Pricing
View Details
Anti-Human IgG Antibody (HRP)
KH-424-01 50 μL

Anti-Human IgG Antibody (HRP)

Sign In for Pricing
View Details
Anti-Human IgG Antibody (HRP)
KH-424-02 100 µL

Anti-Human IgG Antibody (HRP)

Sign In for Pricing
View Details
Anti-Human IgG Antibody (HRP)
KH-424-03 1 mL

Anti-Human IgG Antibody (HRP)

Sign In for Pricing
View Details
Recombinant hnRNP Q Antibody
RC-15854-01 50 μL

Recombinant hnRNP Q Antibody

Sign In for Pricing
View Details
Recombinant hnRNP Q Antibody
RC-15854-02 100 µL

Recombinant hnRNP Q Antibody

Sign In for Pricing
View Details