PPP6R3 Peptide - N-terminal region
PPP6R3 Peptide - N-terminal region
Product Specifications
Product Name Alternative
C11orf23, DKFZp781E17107, DKFZp781E2374, DKFZp781O2362, FLJ11058, FLJ43065, KIAA1558, MGC125711, MGC125712, PP6R3, SAP190, SAPL, SAPLa, SAPS3
UniProt
Q5H9R7
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with PPP6R3 Rabbit Polyclonal Antibody (orb326422) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_060782
Preservative
Lyophilized powder
AA Sequence
PSQEEDRHSNASQSLCEIVRLSRDQMLQIQNSTEPDPLLATLEKQEIIEQ
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC940257-500 1x 500 µL
Cytokeratin, HMW (AE-3), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC740266-500 1x 500 µL
Human IgG Immunoglobulin (IG266), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC471274-100 1x 100 µL
Cytokeratin 10 (Suprabasal Epithelial Marker) (AE20), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNCB0026-500 1x 500 µL
ACTH (Adrenocorticotrophic Hormone) (AH26), Biotin conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC471860-500 1x 500 µL
MUC16 / CA125 (Ovarian Carcinoma Marker) (MUC16/1860), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details