PRDM10 Peptide - middle region
PRDM10 Peptide - middle region
Product Specifications
Product Name Alternative
KIAA1231, MGC131802, PFM7
UniProt
Q9NQV6
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with PRDM10 Rabbit Polyclonal Antibody (orb330052) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_064613
Preservative
Lyophilized powder
AA Sequence
VATPVTTGQVKAVTSGHYVLSESQSELEEKQTSALSGGVQVEPPAHSDSL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![beta Tubulin Mouse Monoclonal Antibody [A1-A4]](https://cdn.genprice.uk/products/992/68dd1c8b061270361ea818aa/imageurl/m1305-2.webp)
BNC881648-100 1x 100 µL
TIMP1 (Marker of Lymph Node Metastasis) (2A5), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
#33015 1 Kit
Tyramide Amplification Kit with HRP Goat Anti-Mouse and CF®680R Tyramide
Sign In for Pricing
View Details 