Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Prdm12 Peptide - middle region

Prdm12 Peptide - middle region

Product Specifications

Product Name Alternative

Gm998

UniProt

A2AJ77

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Prdm12 Rabbit Polyclonal Antibody (orb583763) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001116834

Preservative

Lyophilized powder

AA Sequence

MTYIKCARNEQEQNLEVVQIGTSIFYKAIEMIPPDQELLVWYGNSHNTFL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin 20 (KRT20) (Colorectal Epithelial Marker) (KRT20/3129R), 0.2mg/mL
BNUB3129-100 1x 100 µL

Cytokeratin 20 (KRT20) (Colorectal Epithelial Marker) (KRT20/3129R), 0.2mg/mL

Sign In for Pricing
View Details
Dabigatran-13C6
TRC-D100091-1MG 1 mg

Dabigatran-13C6

Sign In for Pricing
View Details
DOG-1 (DG1/447 + DOG1.1), CF647 conjugate, 0.1mg/mL
BNC470726-500 1x 500 µL

DOG-1 (DG1/447 + DOG1.1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MEK1 (MAP2K1) (+MAP2K2) Rabbit Polyclonal Antibody
AP20701PU-N 100 µg

MEK1 (MAP2K1) (+MAP2K2) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
2-Heptyl Chloroformate
TRC-H282990-250MG 250 mg

2-Heptyl Chloroformate

Sign In for Pricing
View Details
TYRO3 Rabbit Monoclonal Antibody
TA423789 100 µL

TYRO3 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details