Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Prdm12 Peptide - middle region

Prdm12 Peptide - middle region

Product Specifications

Product Name Alternative

Gm998

UniProt

A2AJ77

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Prdm12 Rabbit Polyclonal Antibody (orb583763) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001116834

Preservative

Lyophilized powder

AA Sequence

MTYIKCARNEQEQNLEVVQIGTSIFYKAIEMIPPDQELLVWYGNSHNTFL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mzb1 (NM_027222) Mouse Recombinant Protein
TP501776 20 µg

Mzb1 (NM_027222) Mouse Recombinant Protein

Sign In for Pricing
View Details
MEK1 (MAP2K1) pSer222 Rabbit Polyclonal Antibody
AP13022PU-N 400 µL

MEK1 (MAP2K1) pSer222 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Bcl-6 (Follicular Lymphoma Marker) (rBCL6/1527), CF405S conjugate, 0.1mg/mL
BNC041950-100 1x 100 µL

Bcl-6 (Follicular Lymphoma Marker) (rBCL6/1527), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Aprataxin (APTX) (NM_001195250) Human Over-expression Lysate
LY434146 100 µg

Aprataxin (APTX) (NM_001195250) Human Over-expression Lysate

Sign In for Pricing
View Details
Secretogranin 3 (SCG3) (NM_013243) Human Over-expression Lysate
LY402232 100 µg

Secretogranin 3 (SCG3) (NM_013243) Human Over-expression Lysate

Sign In for Pricing
View Details
4-Nitrophenylglyoxylic Acid
TRC-N232260-1G 1 g

4-Nitrophenylglyoxylic Acid

Sign In for Pricing
View Details