Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Prim1 Peptide - C-terminal region

Prim1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

AI324982, MGC107288

UniProt

P20664

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Prim1 Rabbit Polyclonal Antibody (orb330462) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_032947

Preservative

Lyophilized powder

AA Sequence

EKEKEENEADSKHRVRGYKKTSLAPYVKVFEQFLENLDKSRKGELLKKSD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LTK (NM_002344) Human Recombinant Protein
TP700153 20 µg

LTK (NM_002344) Human Recombinant Protein

Sign In for Pricing
View Details
Frozen Tissue Sections, Esophagus
CS501174 5x 5 µm

Frozen Tissue Sections, Esophagus

Sign In for Pricing
View Details
PE/Cyanine7 Mouse IgG2b, κ Isotype Control[MPC-11]
E-AB-F09813H-01 25 µg

PE/Cyanine7 Mouse IgG2b, κ Isotype Control[MPC-11]

Sign In for Pricing
View Details
PE/Cyanine7 Mouse IgG2b, κ Isotype Control[MPC-11]
E-AB-F09813H-02 100 µg

PE/Cyanine7 Mouse IgG2b, κ Isotype Control[MPC-11]

Sign In for Pricing
View Details
Recombinant Human CD3E&CD3G Heterodimer (C-Fc-6His&C-Fc-Flag)
PKSH034015-01 10 µg

Recombinant Human CD3E&CD3G Heterodimer (C-Fc-6His&C-Fc-Flag)

Sign In for Pricing
View Details
Recombinant Human CD3E&CD3G Heterodimer (C-Fc-6His&C-Fc-Flag)
PKSH034015-02 50 µg

Recombinant Human CD3E&CD3G Heterodimer (C-Fc-6His&C-Fc-Flag)

Sign In for Pricing
View Details