Prim1 Peptide - C-terminal region
Prim1 Peptide - C-terminal region
Product Specifications
Product Name Alternative
AI324982, MGC107288
UniProt
P20664
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Prim1 Rabbit Polyclonal Antibody (orb330462) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_032947
Preservative
Lyophilized powder
AA Sequence
EKEKEENEADSKHRVRGYKKTSLAPYVKVFEQFLENLDKSRKGELLKKSD
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
PKSM040485-01 50 µg
Recombinant Mouse CD122/IL-2RB Protein (His Tag)
Sign In for Pricing
View Details PKSM040485-02 1 mg
Recombinant Mouse CD122/IL-2RB Protein (His Tag)
Sign In for Pricing
View Details 
BNC042751-500 1x 500 µL
CD127 / IL7R (Marker of T-Reg Cells) (IL7R/2751), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
