Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PRKACA Peptide - N-terminal region

PRKACA Peptide - N-terminal region

Product Specifications

Product Name Alternative

MGC102831, MGC48865, PKACA

UniProt

D4ACM4

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PRKACA Rabbit Polyclonal Antibody (orb583733) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_997401

Preservative

Lyophilized powder

AA Sequence

MASNSSDVKEFLAKAKEDFLKKWESPAQNTAHLDQFERIKTLGTGSFGRV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C4-Chloro-1H-pyrazolo[3,4-d]pyrimidin-6-amine
TRC-C383640-5G 5 g

C4-Chloro-1H-pyrazolo[3,4-d]pyrimidin-6-amine

Sign In for Pricing
View Details
Sin3b Mouse Gene Knockout Kit (CRISPR)
KN515793 1 Kit

Sin3b Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
KCTD2 (NM_015353) Human Recombinant Protein
TP318957L 1 mg

KCTD2 (NM_015353) Human Recombinant Protein

Sign In for Pricing
View Details
RWDD1 (NM_001007464) Human Over-expression Lysate
LC423486 20 µg

RWDD1 (NM_001007464) Human Over-expression Lysate

Sign In for Pricing
View Details
RFC4 (NM_181573) Human Recombinant Protein
TP311392L 1 mg

RFC4 (NM_181573) Human Recombinant Protein

Sign In for Pricing
View Details
MSH3 (NM_002439) Human Over-expression Lysate
LY419328 100 µg

MSH3 (NM_002439) Human Over-expression Lysate

Sign In for Pricing
View Details