Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PRKACA Peptide - N-terminal region

PRKACA Peptide - N-terminal region

Product Specifications

Product Name Alternative

MGC102831, MGC48865, PKACA

UniProt

D4ACM4

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PRKACA Rabbit Polyclonal Antibody (orb583733) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_997401

Preservative

Lyophilized powder

AA Sequence

MASNSSDVKEFLAKAKEDFLKKWESPAQNTAHLDQFERIKTLGTGSFGRV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TACC1 Human Gene Knockout Kit (CRISPR)
KN417791 1 Kit

TACC1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CD11c (Dendritic Cell Marker) (ITGAX/1243), Biotin conjugate, 0.1mg/mL
BNCB1243-100 1x 100 µL

CD11c (Dendritic Cell Marker) (ITGAX/1243), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
WT1 (Wilm's Tumor 1) (WT1/857), CF488A conjugate, 0.1mg/mL
BNC880857-500 1x 500 µL

WT1 (Wilm's Tumor 1) (WT1/857), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
C11orf87 (NM_207645) Human Over-expression Lysate
LC403932 20 µg

C11orf87 (NM_207645) Human Over-expression Lysate

Sign In for Pricing
View Details
NM23A (NME1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4G3]
TA801245AM 100 µL

NM23A (NME1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4G3]

Sign In for Pricing
View Details
PE-iFluor® 594 Tandem
2600-AAT 1 mg

PE-iFluor® 594 Tandem

Sign In for Pricing
View Details