Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PRKACA Peptide - N-terminal region

PRKACA Peptide - N-terminal region

Product Specifications

Product Name Alternative

MGC102831, MGC48865, PKACA

UniProt

D4ACM4

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PRKACA Rabbit Polyclonal Antibody (orb583733) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_997401

Preservative

Lyophilized powder

AA Sequence

MASNSSDVKEFLAKAKEDFLKKWESPAQNTAHLDQFERIKTLGTGSFGRV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human FABP2 / I-FABP Protein, His Tag
FA2-H5149-1mg 1 mg

Human FABP2 / I-FABP Protein, His Tag

Sign In for Pricing
View Details
CD46 Mouse Monoclonal Antibody [Clone ID: 122.2]
AM33360PU-T 20 µg

CD46 Mouse Monoclonal Antibody [Clone ID: 122.2]

Sign In for Pricing
View Details
BCL10 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2B12]
TA800447BM 100 µL

BCL10 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2B12]

Sign In for Pricing
View Details
Recombinant FDPS/Farnesyl Diphosphate Synthase Monoclonal Antibody
AN300076P-01 20 µL

Recombinant FDPS/Farnesyl Diphosphate Synthase Monoclonal Antibody

Sign In for Pricing
View Details
Recombinant FDPS/Farnesyl Diphosphate Synthase Monoclonal Antibody
AN300076P-02 100 µL

Recombinant FDPS/Farnesyl Diphosphate Synthase Monoclonal Antibody

Sign In for Pricing
View Details
MAT2A Recombinant Rabbit Monoclonal Antibody [JE33-45]
HA722536 100 µL

MAT2A Recombinant Rabbit Monoclonal Antibody [JE33-45]

Sign In for Pricing
View Details