Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PRKACA Peptide - N-terminal region

PRKACA Peptide - N-terminal region

Product Specifications

Product Name Alternative

MGC102831, MGC48865, PKACA

UniProt

A8K8B9

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PRKACA Rabbit Polyclonal Antibody (orb583734) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_997401

Preservative

Lyophilized powder

AA Sequence

MASNSSDVKEFLAKAKEDFLKKWESPAQNTAHLDQFERIKTLGTGSFGRV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IL1 beta (IL1B) (NM_000576) Human Tagged Lenti ORF Clone
RC202079L3 10 µg

IL1 beta (IL1B) (NM_000576) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
GRIK4 Polyclonal Antibody
MBS2560039-01 0.02 mL

GRIK4 Polyclonal Antibody

Sign In for Pricing
View Details
GRIK4 Polyclonal Antibody
MBS2560039-02 0.06 mL

GRIK4 Polyclonal Antibody

Sign In for Pricing
View Details
GRIK4 Polyclonal Antibody
MBS2560039-03 0.12 mL

GRIK4 Polyclonal Antibody

Sign In for Pricing
View Details
GRIK4 Polyclonal Antibody
MBS2560039-04 0.2 mL

GRIK4 Polyclonal Antibody

Sign In for Pricing
View Details
GRIK4 Polyclonal Antibody
MBS2560039-05 5x 0.2 mL

GRIK4 Polyclonal Antibody

Sign In for Pricing
View Details