Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PRKACA Peptide - N-terminal region

PRKACA Peptide - N-terminal region

Product Specifications

Product Name Alternative

MGC102831, MGC48865, PKACA

UniProt

A8K8B9

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PRKACA Rabbit Polyclonal Antibody (orb583734) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_997401

Preservative

Lyophilized powder

AA Sequence

MASNSSDVKEFLAKAKEDFLKKWESPAQNTAHLDQFERIKTLGTGSFGRV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Dolutegravir O-beta-D-Glucuronide
MBS5797846 Inquire

Dolutegravir O-beta-D-Glucuronide

Sign In for Pricing
View Details
Polyclonal Antibody to High Mobility Group Protein 1 (HMGB1)
TRV-0056939-01 20 µL

Polyclonal Antibody to High Mobility Group Protein 1 (HMGB1)

Sign In for Pricing
View Details
Polyclonal Antibody to High Mobility Group Protein 1 (HMGB1)
TRV-0056939-02 100 µL

Polyclonal Antibody to High Mobility Group Protein 1 (HMGB1)

Sign In for Pricing
View Details
Polyclonal Antibody to High Mobility Group Protein 1 (HMGB1)
TRV-0056939-03 200 µL

Polyclonal Antibody to High Mobility Group Protein 1 (HMGB1)

Sign In for Pricing
View Details
Polyclonal Antibody to High Mobility Group Protein 1 (HMGB1)
TRV-0056939-04 1 mL

Polyclonal Antibody to High Mobility Group Protein 1 (HMGB1)

Sign In for Pricing
View Details
Recombinant Human MICA Protein, C-His
EHH45202 100 μg

Recombinant Human MICA Protein, C-His

Sign In for Pricing
View Details