Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PRKACB Peptide - N-terminal region

PRKACB Peptide - N-terminal region

Product Specifications

Product Name Alternative

DKFZp781I2452, MGC41879, MGC9320, PKACB

UniProt

P22694

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PRKACB Rabbit Polyclonal Antibody (orb583149) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_997461

Preservative

Lyophilized powder

AA Sequence

MGNAATAKKGSEVESVKEFLAKAKEDFLKKWENPTQNNAGLEDFERKKTL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human CD32a/FCGR2A Protein (167 Arg, His Tag)
PKSH030295-01 100 µg

Recombinant Human CD32a/FCGR2A Protein (167 Arg, His Tag)

Sign In for Pricing
View Details
Recombinant Human CD32a/FCGR2A Protein (167 Arg, His Tag)
PKSH030295-02 1 mg

Recombinant Human CD32a/FCGR2A Protein (167 Arg, His Tag)

Sign In for Pricing
View Details
Human IL-1 beta Recombinant Rabbit monoclonal Antibody
HA723882 100 µL

Human IL-1 beta Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
DPP9 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2D6]
TA504020AM 100 µL

DPP9 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2D6]

Sign In for Pricing
View Details
CIAO1 Mouse Monoclonal Antibody [Clone ID: AT6C9]
AM50046PU-N 100 µL

CIAO1 Mouse Monoclonal Antibody [Clone ID: AT6C9]

Sign In for Pricing
View Details
STK33 (NM_030906) Human Over-expression Lysate
LC403089 20 µg

STK33 (NM_030906) Human Over-expression Lysate

Sign In for Pricing
View Details