PRKACB Peptide - N-terminal region
PRKACB Peptide - N-terminal region
Product Specifications
Product Name Alternative
DKFZp781I2452, MGC41879, MGC9320, PKACB
UniProt
P22694
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with PRKACB Rabbit Polyclonal Antibody (orb583149) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_997461
Preservative
Lyophilized powder
AA Sequence
MGNAATAKKGSEVESVKEFLAKAKEDFLKKWENPTQNNAGLEDFERKKTL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNUB2306-100 1x 100 µL
MMP3 (Marker of Metastasis and Rheumatoid Arthritis) (rMMP3/1730), 0.2mg/mL
Sign In for Pricing
View Details 
![CD95 (FAS) Mouse Monoclonal Antibody [Clone ID: UB2]](https://cdn.genprice.uk/products/937/68dd189c061270361e8fcd50/imageurl/am26668rp-n.webp)
AM26668RP-N 50 Tests
CD95 (FAS) Mouse Monoclonal Antibody [Clone ID: UB2]
Sign In for Pricing
View Details ![RRM1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI17C3]](https://cdn.genprice.uk/products/937/68dd1b7b061270361ea1c418/imageurl/ta804723am.webp)
TA804723AM 100 µL
RRM1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI17C3]
Sign In for Pricing
View Details 
