Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PRKAR2A Peptide - middle region

PRKAR2A Peptide - middle region

Product Specifications

Product Name Alternative

MGC3606, PKR2, PRKAR2

UniProt

P13861

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PRKAR2A Rabbit Polyclonal Antibody (orb585056) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_004148

Preservative

Lyophilized powder

AA Sequence

DILVTKDNQTRSVGQYDNRGSFGELALMYNTPRAATIVATSEGSLWGLDR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cpt1b (NM_009948) Mouse Tagged Lenti ORF Clone
MR210564L2 10 µg

Cpt1b (NM_009948) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Galectin 7 Rabbit monoclonal antibody
E43S40843 100 µL

Galectin 7 Rabbit monoclonal antibody

Sign In for Pricing
View Details
AGS Luciferase Reporter Cell Line
ABC-RC025H 1 Vial

AGS Luciferase Reporter Cell Line

Sign In for Pricing
View Details
Anti-Glutamate receptor 3/GRIA3 Antibody Picoband® (PE Conjugate)
PB9206-PE 100 µg/Vial

Anti-Glutamate receptor 3/GRIA3 Antibody Picoband® (PE Conjugate)

Sign In for Pricing
View Details
Recombinant Synechococcus sp. Protein translocase subunit SecA (secA), partial
MBS1360224 Inquire

Recombinant Synechococcus sp. Protein translocase subunit SecA (secA), partial

Sign In for Pricing
View Details
CXorf59 Protein Vector (Human) (pPB-N-His)
PV071538 500 ng

CXorf59 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details