Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PRKCH Peptide - N-terminal region

PRKCH Peptide - N-terminal region

Product Specifications

Product Name Alternative

MGC26269, MGC5363, PKC-L, PKCL, PRKCL, nPKC-eta

UniProt

P24723

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PRKCH Rabbit Polyclonal Antibody (orb583273) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_006246

Preservative

Lyophilized powder

AA Sequence

KKGHQLLDPYLTVSVDQVRVGQTSTKQKTNKPTYNEEFCANVTDGGHLEL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ApoA4 Antibody
KC-1318-01 50 μL

ApoA4 Antibody

Sign In for Pricing
View Details
ApoA4 Antibody
KC-1318-02 100 µL

ApoA4 Antibody

Sign In for Pricing
View Details
ApoA4 Antibody
KC-1318-03 1 mL

ApoA4 Antibody

Sign In for Pricing
View Details
Synaptopodin (SYNPO) (NM_001109974) Human Over-expression Lysate
LY426310 100 µg

Synaptopodin (SYNPO) (NM_001109974) Human Over-expression Lysate

Sign In for Pricing
View Details
(betaS)-beta-Hydroxy-D-tyrosine
TRC-H899965-50MG 50 mg

(betaS)-beta-Hydroxy-D-tyrosine

Sign In for Pricing
View Details
FITC Anti-Mouse FcεRIα Antibody[MAR-1]
E-AB-F1188C-01 50 Tests

FITC Anti-Mouse FcεRIα Antibody[MAR-1]

Sign In for Pricing
View Details