Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PRKCH Peptide - N-terminal region

PRKCH Peptide - N-terminal region

Product Specifications

Product Name Alternative

MGC26269, MGC5363, PKC-L, PKCL, PRKCL, nPKC-eta

UniProt

P24723

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PRKCH Rabbit Polyclonal Antibody (orb583273) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_006246

Preservative

Lyophilized powder

AA Sequence

KKGHQLLDPYLTVSVDQVRVGQTSTKQKTNKPTYNEEFCANVTDGGHLEL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ep-CAM / CD326 (323/A3), CF647 conjugate, 0.1mg/mL
BNC470396-100 1x 100 µL

Ep-CAM / CD326 (323/A3), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Monobutyl Phthalate-D4
TRC-M525102-5MG 5 mg

Monobutyl Phthalate-D4

Sign In for Pricing
View Details
Cd52 (NM_013706) Mouse Tagged ORF Clone
MG200096 10 µg

Cd52 (NM_013706) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
LAT2 Antibody
KC-1339-01 50 μL

LAT2 Antibody

Sign In for Pricing
View Details
LAT2 Antibody
KC-1339-02 100 µL

LAT2 Antibody

Sign In for Pricing
View Details
LAT2 Antibody
KC-1339-03 1 mL

LAT2 Antibody

Sign In for Pricing
View Details