Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PRKCI Peptide - middle region

PRKCI Peptide - middle region

Product Specifications

Product Name Alternative

DXS1179E, MGC26534, PKCI, nPKC-iota

UniProt

P41743

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PRKCI Rabbit Polyclonal Antibody (orb583154) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_002731

Preservative

Lyophilized powder

AA Sequence

TVIPYNPSSHESLDQVGEEKEAMNTRESGKASSSLGLQDFDLLRVIGRGS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bcl-2 (BCL2/796), CF640R conjugate, 0.1mg/mL
BNC400796-500 1x 500 µL

Bcl-2 (BCL2/796), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Chlorphenesin 1-beta-D-Glucuronic Acid
TRC-C424255-5MG 5 mg

Chlorphenesin 1-beta-D-Glucuronic Acid

Sign In for Pricing
View Details
Tissue FFPE Sections, Prostate
CS806539 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details
Pseudomonic Acid C
TRC-P839530-10MG 10 mg

Pseudomonic Acid C

Sign In for Pricing
View Details
RTN4RL1 Human Gene Knockout Kit (CRISPR)
KN416415 1 Kit

RTN4RL1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
ErbB 4 (ERBB4) (NM_001042599) Human Recombinant Protein
TP710093 20 µg

ErbB 4 (ERBB4) (NM_001042599) Human Recombinant Protein

Sign In for Pricing
View Details