Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PRKCI Peptide - middle region

PRKCI Peptide - middle region

Product Specifications

Product Name Alternative

DXS1179E, MGC26534, PKCI, nPKC-iota

UniProt

P41743

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PRKCI Rabbit Polyclonal Antibody (orb583154) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_002731

Preservative

Lyophilized powder

AA Sequence

TVIPYNPSSHESLDQVGEEKEAMNTRESGKASSSLGLQDFDLLRVIGRGS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CYHR1 (NM_032687) Human Over-expression Lysate
LY403193 100 µg

CYHR1 (NM_032687) Human Over-expression Lysate

Sign In for Pricing
View Details
CCNB1IP1 Human qPCR Primer Pair (NM_182851)
HP226373 200 Reactions

CCNB1IP1 Human qPCR Primer Pair (NM_182851)

Sign In for Pricing
View Details
PGEA1 (CBY1) (NM_015373) Human Recombinant Protein
TP320783 20 µg

PGEA1 (CBY1) (NM_015373) Human Recombinant Protein

Sign In for Pricing
View Details
CD47 (23-140) Rabbit Polyclonal Antibody
AP33397PU-N 50 µg

CD47 (23-140) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
LOXL2 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI8B2]
TA807440AM 100 µL

LOXL2 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI8B2]

Sign In for Pricing
View Details
Frozen Tissue Sections, Ovary
CS632771 5x 5 µm

Frozen Tissue Sections, Ovary

Sign In for Pricing
View Details