Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Prmt7 Peptide - C-terminal region

Prmt7 Peptide - C-terminal region

Product Specifications

Product Name Alternative

4933402B05Rik, BC006705, MGC7929

UniProt

Q922X9

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Prmt7 Rabbit Polyclonal Antibody (orb577478) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_663379

Preservative

Lyophilized powder

AA Sequence

GEINDQDRTDHYAQALRTVLLPGSVCLCVSDGSLLSMLAHHLGAEQVFTV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Xab2 Mouse Gene Knockout Kit (CRISPR)
KN519481 1 Kit

Xab2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Nicotinuric Acid
TRC-N433500-250MG 250 mg

Nicotinuric Acid

Sign In for Pricing
View Details
Rxfp3 Mouse Gene Knockout Kit (CRISPR)
KN515223 1 Kit

Rxfp3 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
SAP155 (SF3B1) Mouse Monoclonal Antibody [Clone ID: 1A5]
AM26484AF-N 100 µg

SAP155 (SF3B1) Mouse Monoclonal Antibody [Clone ID: 1A5]

Sign In for Pricing
View Details
Bmf Recombinant Rabbit Monoclonal Antibody [JE33-57]
HA721487 100 µL

Bmf Recombinant Rabbit Monoclonal Antibody [JE33-57]

Sign In for Pricing
View Details
CD14 (Monocyte / Macrophage Marker) (LPSR/2385), CF594 conjugate, 0.1mg/mL
BNC942385-100 1x 100 µL

CD14 (Monocyte / Macrophage Marker) (LPSR/2385), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details