Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Prmt7 Peptide - C-terminal region

Prmt7 Peptide - C-terminal region

Product Specifications

Product Name Alternative

4933402B05Rik, BC006705, MGC7929

UniProt

Q922X9

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Prmt7 Rabbit Polyclonal Antibody (orb577478) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_663379

Preservative

Lyophilized powder

AA Sequence

GEINDQDRTDHYAQALRTVLLPGSVCLCVSDGSLLSMLAHHLGAEQVFTV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD63 (MX-49.129.5), CF405S conjugate, 0.1mg/mL
BNC040525-100 1x 100 µL

CD63 (MX-49.129.5), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
OR51A4 Antibody
8G907-AAT 50 µg

OR51A4 Antibody

Sign In for Pricing
View Details
Cytokeratin 8/18 (C-51), CF740 conjugate, 0.1mg/mL
BNC740034-500 1x 500 µL

Cytokeratin 8/18 (C-51), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Desmoglein-3 (Squamous Cell Marker) (DSG3/2838), 1mg/mL
BNUM2838-50 1x 50 µL

Desmoglein-3 (Squamous Cell Marker) (DSG3/2838), 1mg/mL

Sign In for Pricing
View Details
MCL1 Rabbit Polyclonal Antibody
TA384763 100 µL

MCL1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CD56 (NCAM1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1B9]
TA805376AM 100 µL

CD56 (NCAM1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1B9]

Sign In for Pricing
View Details