Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PROM1 Peptide - C-terminal region

PROM1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

AC133, CD133, CORD12, MCDR2, MSTP061, PROML1, RP41, STGD4

UniProt

O43490

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PROM1 Rabbit Polyclonal Antibody (orb584911) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_006008

Preservative

Lyophilized powder

AA Sequence

KMKLTFEQVYSDCKKNRGTYGTLHLQNSFNISEHLNINEHTGSISSELES

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Syndecan-3 (SDC3) Rat ELISA Kit
H4091 96 Tests

Syndecan-3 (SDC3) Rat ELISA Kit

Sign In for Pricing
View Details
Frozen Tissue Sections, Stomach
CS602429 5x 5 µm

Frozen Tissue Sections, Stomach

Sign In for Pricing
View Details
SLCO1C1 Human Over-expression Lysate
orb1349046 100 µg

SLCO1C1 Human Over-expression Lysate

Sign In for Pricing
View Details
mmu-miR-684 miRNA Antagomir
MBS8318808-01 10 nmol

mmu-miR-684 miRNA Antagomir

Sign In for Pricing
View Details
mmu-miR-684 miRNA Antagomir
MBS8318808-02 20 nmol

mmu-miR-684 miRNA Antagomir

Sign In for Pricing
View Details
mmu-miR-684 miRNA Antagomir
MBS8318808-03 5x 20 nmol

mmu-miR-684 miRNA Antagomir

Sign In for Pricing
View Details