Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PROM1 Peptide - C-terminal region

PROM1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

AC133, CD133, CORD12, MCDR2, MSTP061, PROML1, RP41, STGD4

UniProt

O43490

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PROM1 Rabbit Polyclonal Antibody (orb584911) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_006008

Preservative

Lyophilized powder

AA Sequence

KMKLTFEQVYSDCKKNRGTYGTLHLQNSFNISEHLNINEHTGSISSELES

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IP-10 (1) Alexa Fluor® 680
sc-101500 AF680 200 µg/mL

IP-10 (1) Alexa Fluor® 680

Sign In for Pricing
View Details
Recombinant Rat PLBD2 Protein, His, Yeast-100ug
QP7660-ye-100ug 100ug

Recombinant Rat PLBD2 Protein, His, Yeast-100ug

Sign In for Pricing
View Details
EIF2B3 Mouse Monoclonal Antibody
orb2988396-01 30 µL

EIF2B3 Mouse Monoclonal Antibody

Sign In for Pricing
View Details
EIF2B3 Mouse Monoclonal Antibody
orb2988396-02 50 µL

EIF2B3 Mouse Monoclonal Antibody

Sign In for Pricing
View Details
EIF2B3 Mouse Monoclonal Antibody
orb2988396-03 100 µL

EIF2B3 Mouse Monoclonal Antibody

Sign In for Pricing
View Details
EIF2B3 Mouse Monoclonal Antibody
orb2988396-04 200 µL

EIF2B3 Mouse Monoclonal Antibody

Sign In for Pricing
View Details