Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Pros1 Peptide - C-terminal region

Pros1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

Pros1

UniProt

Q08761

Field of Research

Cardiovascular Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Pros1 Rabbit Polyclonal Antibody (orb582999) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_112348

Preservative

Lyophilized powder

AA Sequence

LGGVPDISFSATPVNAFYSGCMEVNINGVQLDLDEAISKHNDIRAHSCPS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse L-Selectin / CD62L Recombinant Rabbit monoclonal Antibody
HA723875 100 µL

Mouse L-Selectin / CD62L Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Sec8 (EXOC4) (NM_001037126) Human Over-expression Lysate
LY422147 100 µg

Sec8 (EXOC4) (NM_001037126) Human Over-expression Lysate

Sign In for Pricing
View Details
B3GNT5 Human Gene Knockout Kit (CRISPR)
KN206965RB 1 Kit

B3GNT5 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CD63 Human Gene Knockout Kit (CRISPR)
KN401733 1 Kit

CD63 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Silicatein alpha Rabbit Polyclonal Antibody
AP02294SU-S 20 µL

Silicatein alpha Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Taurine-d4
TRC-T007852-25MG 25 mg

Taurine-d4

Sign In for Pricing
View Details