Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Pros1 Peptide - C-terminal region

Pros1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

Pros1

UniProt

Q08761

Field of Research

Cardiovascular Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Pros1 Rabbit Polyclonal Antibody (orb582999) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_112348

Preservative

Lyophilized powder

AA Sequence

LGGVPDISFSATPVNAFYSGCMEVNINGVQLDLDEAISKHNDIRAHSCPS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IL 29 Human, Sf9
OM296590-01 10 µg

IL 29 Human, Sf9

Sign In for Pricing
View Details
IL 29 Human, Sf9
OM296590-02 2 µg

IL 29 Human, Sf9

Sign In for Pricing
View Details
IL 29 Human, Sf9
OM296590-03 1 mg

IL 29 Human, Sf9

Sign In for Pricing
View Details
CEBP Beta (CEBPB) (C-term) Rabbit Polyclonal Antibody
AP17939PU-N 400 µL

CEBP Beta (CEBPB) (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Major Vault Protein (MVP) (1014), CF594 conjugate, 0.1mg/mL
BNC940224-100 1x 100 µL

Major Vault Protein (MVP) (1014), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Bcl-6 (Follicular Lymphoma Marker) (BCL6/1475), CF488A conjugate, 0.1mg/mL
BNC881475-500 1x 500 µL

Bcl-6 (Follicular Lymphoma Marker) (BCL6/1475), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details