Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PLPBP Peptide - C-terminal region

PLPBP Peptide - C-terminal region

Product Specifications

Product Name Alternative

PROSC, EPVB6D

UniProt

O94903

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PLPBP Rabbit Polyclonal Antibody (orb585312) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_009129

Preservative

Lyophilized powder

AA Sequence

PADQVELSMGMSADFQHAVEVGSTNVRIGSTIFGERDYSKKPTPDKCAAD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Kappa Light Chain (B-Cell Marker) (rKLC264), CF647 conjugate, 0.1mg/mL
BNC472171-100 1x 100 µL

Human Kappa Light Chain (B-Cell Marker) (rKLC264), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
SYNC (NM_001161708) Human Over-expression Lysate
LC431422 20 µg

SYNC (NM_001161708) Human Over-expression Lysate

Sign In for Pricing
View Details
Dopamine D2 Receptor Recombinant Rabbit monoclonal Antibody
HA723162 100 µL

Dopamine D2 Receptor Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Cy7® goat anti-mouse IgG (H+L) *Cross Adsorbed*
16864-AAT 1 mg

Cy7® goat anti-mouse IgG (H+L) *Cross Adsorbed*

Sign In for Pricing
View Details
Frozen Tissue Sections, Breast
CS502520 5x 5 µm

Frozen Tissue Sections, Breast

Sign In for Pricing
View Details
CD68 (Macrophage Marker) (C68/2908R), Biotin conjugate, 0.1mg/mL
BNCB2908-500 1x 500 µL

CD68 (Macrophage Marker) (C68/2908R), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details